NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0123338_10014536

Scaffold Ga0123338_10014536


Overview

Basic Information
Taxon OID3300009686 Open in IMG/M
Scaffold IDGa0123338_10014536 Open in IMG/M
Source Dataset NameGlacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - groundupSSSS metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5792
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)8 (80.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Oscillatoria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location NameBorup Fiord, Nunavut, Canada
CoordinatesLat. (o)81.017Long. (o)-81.583Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005661Metagenome / Metatranscriptome393Y
F006886Metagenome / Metatranscriptome362Y
F058553Metagenome / Metatranscriptome135Y
F069716Metagenome123Y

Sequences

Protein IDFamilyRBSSequence
Ga0123338_100145361F069716GGAGMLTNRNQPIIAGLLSLGIVGFAGATALQFNDRIEYKIGNRIETAPSWLVPAKAEFKGVQRGYGGIKILLALLATGGMVTVMLIARKESELEPTRQRIKCYQQKAYEFDFAAESAYQMAQTQQRYNTLLKADGVAFEGEIEQAYMESLGIDPNQQQPVLTGTATLDSVTNPSDKVESTTAPTI
Ga0123338_100145362F006886N/AMNISEFDSSEFDYLNADNFSQSESTNQPTNPEVANIERFWNLTGNWGEFGSYFGAGLSASLIVRAIPALIPSAVILIPAVGLGLGLFSLMAENSAKLRSQLILLAVATALIAGNWDAWQAWIIANSQLLIFSLALIVITLGFVGTQIWSKLNNVNE*
Ga0123338_100145363F005661AGGAGMTLTFRVAQTPGAAHVAKEFGYQSGPLTPEIVHEAARQAKILDLQKQLRTAYNRHCDKIRTNKVEIERLTLEAIESGLKDKAEIDKYVSKAIIAAAKHDQHIVNLSQKLQHELGLIKVEGASTQTLQNMDFRQRLLLIKANHQAKGQIQANGFQQSLKAIQASPQQAIAMQGRRTNFNNYINAKDFDAIPAVPGGSSGGNNSAMSVGGNDKGFLGGLFDFFSGRK*
Ga0123338_100145365F058553AGGAGMAQARAVMPSKFVPLADELLAATGANDYSTLIGILLSRYGNHLLNTWQINNCPQAVAAIQQPITEHLATPTTAPEQFTPMEF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.