NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0114933_10139809

Scaffold Ga0114933_10139809


Overview

Basic Information
Taxon OID3300009703 Open in IMG/M
Scaffold IDGa0114933_10139809 Open in IMG/M
Source Dataset NameDeep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1674
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Various Oceans To Uncover New Lineages Of Life (Nelli)

Source Dataset Sampling Location
Location NameKolumbo volcano, Aegean Sea
CoordinatesLat. (o)36.5275Long. (o)25.4871Alt. (m)Depth (m)495
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000302Metagenome / Metatranscriptome1337Y
F000896Metagenome / Metatranscriptome845Y
F033113Metagenome / Metatranscriptome178Y
F037814Metagenome / Metatranscriptome167N

Sequences

Protein IDFamilyRBSSequence
Ga0114933_101398092F000896AGGAGMTNKINMVINLSILALLIYLAISVKKIEDKVFPDPNIMIPLIGNMDSKSELEYNIRTFLNNALSKAIEEQENQ*
Ga0114933_101398094F000302GGAGGMVAVMSQDTKDRIADLERQKIELENRLEHLGYSGNLVRMHQIEEEIYEIEDTIRKLLP*
Ga0114933_101398095F033113AGGAGMLKTIEKKIQSFVEGIGGIQRQEIVHGTLYVKLDNDRDCDFIHTEIRKFYKEFINPEGGVNMYAVGDEFAFDFVPTDRETPVFSDDEESLYGIWSEFAEEGLEKDMPDDVDTLLNLEEEMKRGK*
Ga0114933_101398096F037814AGGGGGMEISLAISIVMLLVIIVSFTYMLKELKECQKIIKKMQKRSRKYIREVVSND*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.