Basic Information | |
---|---|
Taxon OID | 3300009739 Open in IMG/M |
Scaffold ID | Ga0123362_1123442 Open in IMG/M |
Source Dataset Name | Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_194_18m (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 530 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Sar | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Microbial And Viral Regulation Of Community Carbon Cycling Across Diverse Low-Oxygen Zones |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Louisana Shelf, Hypoxic Zone, Gulf of Mexico | |||||||
Coordinates | Lat. (o) | 28.8679 | Long. (o) | -90.4764 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000248 | Metatranscriptome | 1460 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0123362_11234421 | F000248 | N/A | MRAVVLVVASILCSSNAALVKKTKLDINQKAYIENAAVLGDGAGQGNLNVCMELADHFVANPNAPNVKVCGTGIKMTVFLLGRCGEGSLTAAKMAHTWDVGACDTGAPPSTCKSFGPASDKRMGAAQSYKITQC* |
⦗Top⦘ |