NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0116168_1068840

Scaffold Ga0116168_1068840


Overview

Basic Information
Taxon OID3300009761 Open in IMG/M
Scaffold IDGa0116168_1068840 Open in IMG/M
Source Dataset NameActive sludge microbial communities of municipal wastewater-treating anaerobic digesters from Canada - AD_UKC129_MetaG
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)999
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → unclassified Eubacteriales → Clostridiales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge → Active Sludge Microbial Communities Of Municipal Wastewater-Treating Anaerobic Digesters From Various Locations

Source Dataset Sampling Location
Location NameCanada
CoordinatesLat. (o)49.25Long. (o)-123.1Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F014634Metagenome / Metatranscriptome261Y
F048731Metagenome / Metatranscriptome147Y
F103107Metagenome / Metatranscriptome101Y

Sequences

Protein IDFamilyRBSSequence
Ga0116168_10688401F103107N/ANERMVYVTKSRIVYWIDEKTGGYIELAGTRWDGDLSDQELLARALEEAEEAGLDLSYGKIIIEMEDGEE*
Ga0116168_10688402F014634GGAGGMIRERIKEIFDLNRIREYAEANIDLTEWIEEECGEKRKILEVVTLFHSANGAYIPGMVLELFGQAEGYDLENPYNYDKNETIHEALMFLENEVNDCLNELLPSKGVYYIGYHEADGSYCLFYEEYEEEE*
Ga0116168_10688403F048731AGGAGGMIEKALRYALTISEDPKEIKKHVEEYMAAAGFDRRYRFKWCAFSGNHKYTFSGIFEYAGQRYYFNRLNGLHLEKI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.