Scaffold Ga0115001_10997945

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0115001_10997945

Scaffold Ga0115001_10997945

Overview

Basic Information
Taxon OID	3300009785 Open in IMG/M
Scaffold ID	Ga0115001_10997945 Open in IMG/M
Source Dataset Name	Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_130
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Maribacter → unclassified Maribacter → Maribacter sp.	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Western Arctic Ocean

Source Dataset Sampling Location
Location Name	Arctic Ocean: Canada Basin
Coordinates	Lat. (^o)	77.0991	Long. (^o)	-150.2252	Alt. (m)		Depth (m)	5
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101907	Metagenome / Metatranscriptome	102	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0115001_109979451	F101907	N/A	MAYDSTIPAGGHANFVSPNTAQEHEGVAVDFITVDLLTTAAAEVTHPLAAANTAGLHLIREAIQNQGVNILGNGVQSAAFEHTFMVRRDSLDTISSTTTAAAIQAAIRALNANTKITQTISSATAADRDMGKLTAMA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.