Basic Information | |
---|---|
Taxon OID | 3300009794 Open in IMG/M |
Scaffold ID | Ga0105189_1036547 Open in IMG/M |
Source Dataset Name | Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3438_5245 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 500 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexi incertae sedis → SAR202 cluster → SAR202 cluster bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Southern Atlantic ocean | |||||||
Coordinates | Lat. (o) | -9.4986 | Long. (o) | -25.9999 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024570 | Metagenome | 205 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0105189_10365471 | F024570 | N/A | MYNKSIKVNKFFGENKMNYVAYETRMTKDTPTGMRYLVRCNRLNKWAICSWVSSTGAAIGNPECQGKYEYVMKKWHKLVGKYVSVT* |
⦗Top⦘ |