NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105079_1031223

Scaffold Ga0105079_1031223


Overview

Basic Information
Taxon OID3300009805 Open in IMG/M
Scaffold IDGa0105079_1031223 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_0_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)563
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F026823Metagenome196N
F065769Metagenome / Metatranscriptome127Y

Sequences

Protein IDFamilyRBSSequence
Ga0105079_10312231F026823GGAGMARGLKPRVEPAIEAALQKKGNLSDLDLAKLCFCARRSAARVLFDMHRFKLVHISGYFKVSCNGRHRPLWSW
Ga0105079_10312232F065769N/AEYSPEEKGSTDSLGANYEPDIEECMTLNNAYIAGTDVDIAHMILQSMVDHIEVSALEKFLDK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.