NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0105070_1046225

Scaffold Ga0105070_1046225


Overview

Basic Information
Taxon OID3300009815 Open in IMG/M
Scaffold IDGa0105070_1046225 Open in IMG/M
Source Dataset NameGroundwater microbial communities from the Columbia River, Washington, USA - GW-RW S1_0_10
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)801
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand → Groundwater Microbial Communities From The Columbia River, Washington, Usa

Source Dataset Sampling Location
Location NameUSA: Columbia River, Washington
CoordinatesLat. (o)46.372Long. (o)-119.272Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006541Metagenome / Metatranscriptome370Y

Sequences

Protein IDFamilyRBSSequence
Ga0105070_10462251F006541GAGGMQRRRVCAVVGVSFSLVSVVSAFGQGAQQPQVMIEIVYPRHVARGQTTVINVAVPSRDTVKAAEISPSTGVTVTGIKGSGRETEQAIGWWEITLDVAKDAAPGDRSLVLVMQMDRTAPATISVPTHVPTISELRIVPPQSNQPTIELRLTAADASADLGDSPYVWFTAGCGGEPLVGAVRGKLSAGVVRAVLPNLRKAAGDGTTAAGKCDLQVRVTDSTGIDSNTLKSIVEFGN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.