Scaffold Ga0123355_10971732

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0123355_10971732

Scaffold Ga0123355_10971732

Overview

Basic Information
Taxon OID	3300009826 Open in IMG/M
Scaffold ID	Ga0123355_10971732 Open in IMG/M
Source Dataset Name	Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	907
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany

Source Dataset Sampling Location
Location Name	Petit - Saut dam, French Guiana
Coordinates	Lat. (^o)	5.0626	Long. (^o)	-53.0462	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F041383	Metagenome / Metatranscriptome	160	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0123355_109717322	F041383	AGAAG	MVSAKETRTAAPETQKWSFSADGKPLSLDEFLETYKKQGIFFEGKEQWLKGVTKVSWENFFLVCTEELDDISQRAAKMLIHYCLEI

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.