NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0130086_1057633

Scaffold Ga0130086_1057633


Overview

Basic Information
Taxon OID3300009829 Open in IMG/M
Scaffold IDGa0130086_1057633 Open in IMG/M
Source Dataset NameSorghum rhizosphere soil microbial communities under drought stress in Albany, CA - sample D
Source Dataset CategoryMetatranscriptome
Source Dataset Use PolicyOpen
Sequencing CenterQB3 Vincent J. Coates Genomics Sequencing Laboratory
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)749
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Sorghum Rhizosphere Soil Microbial Communities From California, Usa

Source Dataset Sampling Location
Location NameCalifornia,USA
CoordinatesLat. (o)37.887207Long. (o)-122.304401Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009871Metagenome / Metatranscriptome311Y

Sequences

Protein IDFamilyRBSSequence
Ga0130086_10576331F009871N/AEVTENIEEVKDAVEENTNYIITKDRLPQNKAYARKRVEDIYEHGELAKGRLVENAEHVVHSTIAGIKDAAEAIEDNTKFVIPHDHLANPNGKPVIEKTIDLTDDVNRAIERAKEAQPKIIENTTVDLTDRLKNLVPKVEENITVDLTDRLKNLVPKDDQPEGIKENANWAKEGIKDNVNYAKDVFGENASHKENTHFTQNVLAGNVNYAKESQTEVLAKGLPVDSKDRTPEYSPNINVVLNNPLRFEIV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.