Basic Information | |
---|---|
Taxon OID | 3300009853 Open in IMG/M |
Scaffold ID | Ga0118741_1018456 Open in IMG/M |
Source Dataset Name | Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - F3EC |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Molecular Research LP (MR DNA) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 602 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → malvids → Sapindales → Anacardiaceae → Pistacia → Pistacia vera | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Lacaze-Duthiers Canyon | |||||||
Coordinates | Lat. (o) | 42.4666667 | Long. (o) | 3.4666667 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F023843 | Metagenome / Metatranscriptome | 208 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0118741_10184561 | F023843 | N/A | MMNNGKIEIEKFNGKSFELWKLKMEDLLVDKDQWIAVDLGTKPTGVTDEEW* |
⦗Top⦘ |