Scaffold Ga0130078_13832246

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0130078_13832246

Scaffold Ga0130078_13832246

Overview

Basic Information
Taxon OID	3300009869 Open in IMG/M
Scaffold ID	Ga0130078_13832246 Open in IMG/M
Source Dataset Name	Cow rumen microbiome (microbial/fungal) from cows held on UI at Urbana campus farm, Champaign, IL - Corn Stover. Combined Assembly of Gp0148673, Gp0148674
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	U.S. Department of Energy (DOE)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1232
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Oligohymenophorea → Hymenostomatida	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Rumen → Cow Rumen Metatranscriptome

Source Dataset Sampling Location
Location Name	University of Illinois at Urbana - Champaign, Illinois, USA
Coordinates	Lat. (^o)	40.096	Long. (^o)	-88.2315	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F089670	Metagenome / Metatranscriptome	108	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0130078_138322461	F089670	N/A	YFLVAFIFILLKMFNFITYTEIVLAYFCYCIYVQFTSKTYLYYTKNEKNEKLLSMCPELANPNYKPHFLFPFAFQQMFLSLNNLLIQDKPKLKFREQKVNKYGLTLFWPFFSDFEEISDPNTPILFFLPGMTGEISDPYVINICIEGLKMDIMYVCIR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.