Scaffold Ga0131092_10788066

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0131092_10788066

Scaffold Ga0131092_10788066

Overview

Basic Information
Taxon OID	3300009870 Open in IMG/M
Scaffold ID	Ga0131092_10788066 Open in IMG/M
Source Dataset Name	Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Linkou plant
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Beijing Novogene Bioinformatics Technology Co., Ltd
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	796
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Comamonadaceae → Xenophilus → unclassified Xenophilus → Xenophilus sp. L33	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan

Source Dataset Sampling Location
Location Name	Tai Wan
Coordinates	Lat. (^o)	25.0	Long. (^o)	121.0	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052810	Metagenome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0131092_107880661	F052810	GGAG	MNPHITRKWLVLFILGASLSIGQGMAQNIGSLFQLMGGMDTVKKLSSSLLQSSAKDPRLAGLLGKADTNAVSPKLADQMCSMLGGGCKAPVTDQQIAAGAGKLDASQTQALGDNFSSALSGVTSNPLIKEGVSKAIAPKLGGIVGALI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.