 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300009873 Open in IMG/M |
| Scaffold ID | Ga0131077_10699621 Open in IMG/M |
| Source Dataset Name | Activated sludge microbial diversity in wastewater treatment plant from Taiwan - Wenshan plant |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | Beijing Novogene Bioinformatics Technology Co., Ltd |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 900 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Engineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Wastewater → Activated Sludge Microbial Community Analysis In Wastewater Treatment Plant From Tai Wan |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Tai Wan | |||||||
| Coordinates | Lat. (o) | 24.0 | Long. (o) | 120.0 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F085840 | Metagenome / Metatranscriptome | 111 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0131077_106996212 | F085840 | N/A | VYEPLERHSFEHALFHLAMAAFGLVTGLGASRLTPLGGRITAFLSIGMLLMFAAAMKGG* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |