NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0131848_1012344

Scaffold Ga0131848_1012344


Overview

Basic Information
Taxon OID3300009950 Open in IMG/M
Scaffold IDGa0131848_1012344 Open in IMG/M
Source Dataset NameCompost microbial communities from Sao Paulo Zoo, Brazil - Zoo Compost 4 - DAY 64 mira
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCenter for Advanced Technologies in Genomics, Sao Paulo University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1536
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Source Dataset Sampling Location
Location NameSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029085Metagenome / Metatranscriptome189N
F047639Metagenome / Metatranscriptome149Y
F075995Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0131848_10123441F047639N/ATITYHLSSKFKPDFLINPDHIFIYNGYRTVIITDKSAETINPLXFNSKFNASDFKTAIESKLIKDTFSTLKHNTFDLTKFLLLLNIVITLGVFYFLLKSQGVI*
Ga0131848_10123442F029085AGGMKDIKNDKLXIXXLLEENIXEQLESGSSDLVSLIAISELTNLEKLKVITRLKDEQVPLLAKLYMXAETFNVPFXKNLADNILQLQISIRGLGRKELVNIVRESTPTETKRSLFGPKDVFR
Ga0131848_10123443F075995AGGAGGMSKYRPLRKANVYITKNFKKVFYGMRTLYVKDHTGRVFIRYKNRYYQAYFDGYHTYHVRLK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.