Scaffold Ga0133903_1000432

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0133903_1000432

Scaffold Ga0133903_1000432

Overview

Basic Information
Taxon OID	3300010017 Open in IMG/M
Scaffold ID	Ga0133903_1000432 Open in IMG/M
Source Dataset Name	Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample H3
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2047
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Source Dataset Sampling Location
Location Name	Carrie Bow Cay Field Station, Belize
Coordinates	Lat. (^o)	16.80288	Long. (^o)	-88.08213	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028418	Metagenome / Metatranscriptome	191	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0133903_10004323	F028418	N/A	DLNYNFECDWLIELSDNKLSNNILASELVENRSFLNQSQSQKL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.