NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126338_10075192

Scaffold Ga0126338_10075192


Overview

Basic Information
Taxon OID3300010030 Open in IMG/M
Scaffold IDGa0126338_10075192 Open in IMG/M
Source Dataset NameCoral microbial communities from Petempiche,Puerto Morelos, Mexico - Orbicella C C metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1685
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NamePetempiche,Puerto Morelos, Mexico
CoordinatesLat. (o)20.9047Long. (o)-86.8366Alt. (m)Depth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032532Metagenome / Metatranscriptome179Y
F032533Metagenome / Metatranscriptome179Y
F051692Metagenome / Metatranscriptome143Y

Sequences

Protein IDFamilyRBSSequence
Ga0126338_100751921F032533GAGMLSDDLGEKKIFAEGFEFLHVVFNVIEKRGPVFLSLVFASFSSYNVCKHTWLFLAMSLGVYLLNSKQADCL*
Ga0126338_100751922F051692AGGAMIATHKFLGCNQLIVTQKLLNWNDMIVTHKLLDCNEMILTDKLLHYKELIVTHKLLDCNEVIVTHKLLYCNELIVTHKLLDCNELIITHKLLDCNEVIN*
Ga0126338_100751923F032532GAGMVTHKLLHCNELIVTHKSLDCNELIVTHKLLGCNEEIVTHKLLHCNELIVTHKLLDCNELIATHKLLDCNELIVTHKLMDCNELLVTHKLLDCNEVIVTHKLLGCNKLIVTHKLLDSNEVIVTHKLLHCNELIVTHKLLDYNEVFLTHKLLDCNDMIVTHKLLDCNQLIVTHKY*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.