NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126337_10000693

Scaffold Ga0126337_10000693


Overview

Basic Information
Taxon OID3300010031 Open in IMG/M
Scaffold IDGa0126337_10000693 Open in IMG/M
Source Dataset NameCoral microbial communities from La Bocana,Puerto Morelos, Mexico - Diploria C A metagenome
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)18227
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (21.74%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Cnidaria → Anthozoa → Hexacorallia → Scleractinia(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Invertebrates → Cnidaria → Coral → Unclassified → Coral → Coral Microbial Communities From Various Locations To Study Host-Microbial Communication

Source Dataset Sampling Location
Location NameLa Bocana,Puerto Morelos, Mexico
CoordinatesLat. (o)20.8777Long. (o)-86.843Alt. (m)Depth (m)4
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001105Metagenome / Metatranscriptome776Y
F032145Metagenome / Metatranscriptome180Y
F048764Metagenome / Metatranscriptome147Y

Sequences

Protein IDFamilyRBSSequence
Ga0126337_1000069316F048764N/AMSVQENETKILPTYSEKTLKGMKAERAVKRITFDRTEASPGETLYVSVPTLNKNEVLVPGSLALRFDIDLSGGHANNFLVQNVTRALVDKLLVRFGGTILQDTVGYDIYKIFEHLFLSQEKLDGMILEGIQSEDLRKIRSGARDKKTSGVDAKNKLNDIFGKKVPYQSRPSDLN*
Ga0126337_1000069322F001105N/AMSDNKVVKTIMDAATLIGLAAGIGWASTKVLKENFTSDPSSGAMNYVNFTAVMAGSIALKQYLDDQKILPSAV*
Ga0126337_1000069323F032145N/AMVGGAVLNAAAFIGGNYLARALGGGDKAALEEKELHDKVLEAYQAAYANYTRDRTKPLDWIETKAQIKAEAKQNFTNTDYAFKLYNQAHHDEPIEPSKEPKFSDFYQPSE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.