Scaffold Ga0126314_10001260

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126314_10001260

Scaffold Ga0126314_10001260

Overview

Basic Information
Taxon OID	3300010042 Open in IMG/M
Scaffold ID	Ga0126314_10001260 Open in IMG/M
Source Dataset Name	Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot105B
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	12091
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location Name	UC McLaughlin Reserve (Lake County, CA)
Coordinates	Lat. (^o)	38.8723	Long. (^o)	-122.4268	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F001264	Metagenome / Metatranscriptome	735	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126314_1000126015	F001264	AGGAG	MRPEQTMAEMAEDVLSRQARAQVQRTGQSRASARAAVIQTPAGCQLEELRTGAHQHEEVRYWQANLLFKRVCEQASHPV*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.