NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0126310_10135108

Scaffold Ga0126310_10135108


Overview

Basic Information
Taxon OID3300010044 Open in IMG/M
Scaffold IDGa0126310_10135108 Open in IMG/M
Source Dataset NameSerpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot60
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1549
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Rubrobacteria → Rubrobacterales → Rubrobacteraceae → Rubrobacter → Rubrobacter tropicus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil → Serpentine Soil Microbial Communities From Uc Mclaughlin Reserve, Ca, Usa

Source Dataset Sampling Location
Location NameUC McLaughlin Reserve (Lake County, CA)
CoordinatesLat. (o)38.8711Long. (o)-122.4276Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023207Metagenome / Metatranscriptome211Y
F041422Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0126310_101351081F041422GAGMVFTKPYAREQEAGVPKTGGLGRVKNILAASTRQDWEADGPRLWVRKGDTKLRIVDLTDDEGRVELKEQWARNAGAGSVALRVELSICHGSELLAKVPAVCVDSGRAFIPWPEEEKDGRLVVAGWHYDLCRVISAGEYLGAHPVRSYLRQAGIVVI*
Ga0126310_101351082F023207GAGMEVWSEGVVQRGKEKTLHRDQTIYEMVEEVLTNQAKSLAERTGQAFESALEVVADTEAGQQLRELGNGEHRHKKAREWQAGVRFERAEQQLMHLFGSDVLSRLAGERQSSWVAGYLEWLEGKEARTPYHALLEEELASLQG*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.