Basic Information | |
---|---|
Taxon OID | 3300010110 Open in IMG/M |
Scaffold ID | Ga0126316_1045117 Open in IMG/M |
Source Dataset Name | Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 526 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Fluxnet siteBondville, Illinois | |||||||
Coordinates | Lat. (o) | 40.0062 | Long. (o) | -88.2904 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F004612 | Metagenome / Metatranscriptome | 431 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0126316_10451172 | F004612 | N/A | MQSLVVKISNPDTVHAIAEAAKRQGTTPEAAALELLETAVLAQKPFDEIVEPIARSFDESGMSEEELDDLVKQTQKAIREERRRNK* |
⦗Top⦘ |