Scaffold Ga0126316_1127367

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0126316_1127367

Scaffold Ga0126316_1127367

Overview

Basic Information
Taxon OID	3300010110 Open in IMG/M
Scaffold ID	Ga0126316_1127367 Open in IMG/M
Source Dataset Name	Soil microbial communities from Illinois, USA to study soil gas exchange rates - BV-IL-AGR metaT (Metagenome Metatranscriptome)
Source Dataset Category	Metatranscriptome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	900
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil → Soil Microbial Communities From Various Locations In Usa And Cambodia To Study Soil Gas Exchange Rates

Source Dataset Sampling Location
Location Name	Fluxnet siteBondville, Illinois
Coordinates	Lat. (^o)	40.0062	Long. (^o)	-88.2904	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028190	Metagenome / Metatranscriptome	192	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0126316_11273671	F028190	N/A	MASITVKKFDGVTDIVYDALSASGGDGSPAVWRQDTGAASALPVGLRQTLKLWSTWNGPKTARQMKFNFVFPYAVQDSTTTLYSAKDRMVADMIITMPQGIPAATLNEVYQFMNLVAATLVKQSVAAGYAPT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.