Basic Information | |
---|---|
Taxon OID | 3300010138 Open in IMG/M |
Scaffold ID | Ga0115595_1070780 Open in IMG/M |
Source Dataset Name | Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_B (Metagenome Metatranscriptome) |
Source Dataset Category | Metatranscriptome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 909 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland → Wetland Microbial Communities From Old Woman Creek Reserve In Ohio, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Old Woman Creek National Estuarine Research Reserve, Ohio, USA | |||||||
Coordinates | Lat. (o) | 41.2239 | Long. (o) | -82.3039 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F049453 | Metagenome / Metatranscriptome | 146 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0115595_10707802 | F049453 | GGA | MRPETPLAVENSVGKLAAKSAPNVSPGKRAWRTPIPH |
⦗Top⦘ |