Scaffold Ga0114960_10282857

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0114960_10282857

Scaffold Ga0114960_10282857

Overview

Basic Information
Taxon OID	3300010158 Open in IMG/M
Scaffold ID	Ga0114960_10282857 Open in IMG/M
Source Dataset Name	Freshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_MF_MetaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	837
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location Name	Lake Croche, Canada
Coordinates	Lat. (^o)	46.8319	Long. (^o)	-72.5	Alt. (m)		Depth (m)	3
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007742	Metagenome	345	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0114960_102828574	F007742	N/A	MLRVLHHMTYFNTKAAAQALADALAMDDADAWLYEVHASPRGFYVAVFDFDHFFLGNL*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.