Scaffold Ga0136215_1000158

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0136215_1000158

Scaffold Ga0136215_1000158

Overview

Basic Information
Taxon OID	3300010226 Open in IMG/M
Scaffold ID	Ga0136215_1000158 Open in IMG/M
Source Dataset Name	Soil microbial communities from Bangor area, North Wales, UK enriched with cashew seed oil ? week3, replicate 2
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Fidelity Systems Inc
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	38915
Total Scaffold Genes	50 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	26 (52.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Soil → Soil Microbial Communities From Bangor Area, North Wales, Uk Enriched With Cashew Seed Oil

Source Dataset Sampling Location
Location Name	Bangor area, North Wales, UK
Coordinates	Lat. (^o)	53.24	Long. (^o)	-4.01	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F063851	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0136215_100015836	F063851	N/A	LNIEIIKGENMKNIKNRQGIFLSVMILFLIIGDLQIPYYLANADALKSIYSTIPSWYPVYALVGLASNIAIIIGMWRMKKWSAYLLVAYFASKFLVDLMYVVPEKQMLVFMTTLAGAIFWFWAIRRKWNLFS*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.