NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136246_10009313

Scaffold Ga0136246_10009313


Overview

Basic Information
Taxon OID3300010236 Open in IMG/M
Scaffold IDGa0136246_10009313 Open in IMG/M
Source Dataset NameTerrestrial oil reservoir microbial community from Schrader Bluff Formation, Alaska - SB1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterYale Center for Genome Analysis
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2615
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium ADurb.BinA104(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Produced Fluid → Terrestrial Oil Reservoir Microbial Communities From Alaska

Source Dataset Sampling Location
Location NameAlaska, USA
CoordinatesLat. (o)70.4Long. (o)-148.7Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F024777Metagenome / Metatranscriptome204Y
F025938Metagenome / Metatranscriptome199Y

Sequences

Protein IDFamilyRBSSequence
Ga0136246_100093133F025938AGGAGMVVIPDKIVDLLSAMFEDVRDKQFIIGDTLIDIVNATGDKAGTIAYLAGRLGVSASTLYDYYRIAKLWTSEYRAMYQALDWTIYRNADPNDPEDRALLEKCIDEGWNATKFKEQKYPTLQDPGAILGKMVAMGKRLYEQDTLEIEQREEILKAISILQEIMEELELIGVALERA*
Ga0136246_100093134F024777GAGMKGVKMDAELIFAEDVEVCPKCGSSEFWENRIIWVGDDPTDEELASIECKVCGAVFYARDYYRRRFGKLEDDEEIPF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.