Scaffold Ga0134090_1034522

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0134090_1034522

Scaffold Ga0134090_1034522

Overview

Basic Information
Taxon OID	3300010281 Open in IMG/M
Scaffold ID	Ga0134090_1034522 Open in IMG/M
Source Dataset Name	Switchgrass degrading microbial communities from high solid loading bioreactors in New Hampshire, USA - 1_4_20_6_A1 metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1175
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Tissierellia → unclassified Tissierellia → Tissierellia bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Switchgrass Degrading → Switchgrass Degrading Microbial Communities From High Solid Loading Bioreactors In New Hampshire, Usa

Source Dataset Sampling Location
Location Name	USA: Dartmouth College, New Hampshire
Coordinates	Lat. (^o)	43.726	Long. (^o)	-72.1429	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087072	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0134090_10345221	F087072	GAGG	MKSKVFTKRIFLLELSEEELGIIAGALYCANSEDIKSFVDKYKYPCSGYSFDEVAELQEKLSEEINKLIENRKIGLYNKEGQLPNG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.