Scaffold Ga0129307_1000677

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129307_1000677

Scaffold Ga0129307_1000677

Overview

Basic Information
Taxon OID	3300010282 Open in IMG/M
Scaffold ID	Ga0129307_1000677 Open in IMG/M
Source Dataset Name	Capybara group fecal microbial communities from Wisconsin, USA - P1105 metagenome
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	48492
Total Scaffold Genes	54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	36 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Large Intestine → Fecal → Capybara Group Fecal → Animal Gut Microbial Communities From Fecal Samples From Wisconsin, Usa

Source Dataset Sampling Location
Location Name	USA: Wisconsin
Coordinates	Lat. (^o)	43.07	Long. (^o)	-89.4	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082888	Metagenome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129307_100067734	F082888	AGAAG	MEEDNMSQIIEINVENQEYQIEWALSEYFDELKGMKFMLNSVAADQIVMINNLSETAKILLSAVAGAVIQYLIDNNCPIDSIFESGYFIIRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.