Scaffold Ga0129301_1000749

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129301_1000749

Scaffold Ga0129301_1000749

Overview

Basic Information
Taxon OID	3300010284 Open in IMG/M
Scaffold ID	Ga0129301_1000749 Open in IMG/M
Source Dataset Name	Hot spring microbial mat communities from California, USA to study Microbial Dark Matter (Phase II) - Cone Pool mat layer H metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	17124
Total Scaffold Genes	16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	9 (56.25%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Microbial Mats → Hot Spring Microbial Mat → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	37.4127	Long. (^o)	-118.504	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F074155	Metagenome	120	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129301_100074916	F074155	GGAGG	MAANLLSFDFIRGRLSAEQLEDLAVSLGLCLECGGSLAVRDGEVVCSHCGLVWSVENVDESLPFPEDGEDGDGVAKCFEGHWQPGNRLAFLKGFGDPALANCKGKALMRVLAKSPNGAVDLGLRATQIRALVEWEDPPQLRRVLSRISFLLAVMGQRENWLLADYAGKLARKLVAFKIISKQPISYRLGDTVVVYALKKFNMKTDFSKLKISIEDLRLITQLENTQTKKQPNKPSINSN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.