Scaffold Ga0129302_1001216

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0129302_1001216

Scaffold Ga0129302_1001216

Overview

Basic Information
Taxon OID	3300010291 Open in IMG/M
Scaffold ID	Ga0129302_1001216 Open in IMG/M
Source Dataset Name	Hot spring sediment bacterial and archeal communities from California, USA to study Microbial Dark Matter (Phase II) - Blank Spring sediment metaG
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	19384
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	12 (52.17%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring Sediment → Bacterial And Archaeal Communities From Various Locations To Study Microbial Dark Matter (Phase Ii)

Source Dataset Sampling Location
Location Name	USA: California
Coordinates	Lat. (^o)	39.0314	Long. (^o)	-122.4323	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F098703	Metagenome	103	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0129302_100121619	F098703	N/A	MVKKVHIIINLLSEASKKSDSQIEEKIRNEAKIPLCSNIEDVSVEDTEESYNNLKKHGISSNVARNLLDLYTE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.