NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136644_10069312

Scaffold Ga0136644_10069312


Overview

Basic Information
Taxon OID3300010334 Open in IMG/M
Scaffold IDGa0136644_10069312 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130820_EF_MetaG (v2)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2234
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (30.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)3
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036564Metagenome / Metatranscriptome169N
F044916Metagenome / Metatranscriptome153Y
F064403Metagenome / Metatranscriptome128N

Sequences

Protein IDFamilyRBSSequence
Ga0136644_100693123F036564GGAGMKLGRVTLDISYIVDMDNEDMVKHAIESFYEDLMQGVKYGDITDWIDVVEDKNATEDMIPEFLLEKEND*
Ga0136644_100693124F064403GGAGMTNPRSKILSDLKRAYLKEHPVTLVDRILGYLNNLTDFQLCQLYSEKYETNPKYIAEQFEFKF*
Ga0136644_100693125F044916N/AMGRKKIEKSRIEKGLEKEEKTFALMAKKIVDAIKDEKFLRDFTKDCLEELYKDNPKLFADHAKIKLNKK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.