NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0129333_10193045

Scaffold Ga0129333_10193045


Overview

Basic Information
Taxon OID3300010354 Open in IMG/M
Scaffold IDGa0129333_10193045 Open in IMG/M
Source Dataset NameFreshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1854
Total Scaffold Genes9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (11.11%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient → Aqueous Microbial Communities From The Delaware River/Bay And Chesapeake Bay Under Freshwater To Marine Salinity Gradient To Study Organic Matter Cycling In A Time-Series

Source Dataset Sampling Location
Location NameUSA: Chesapeake Bay
CoordinatesLat. (o)39.2637Long. (o)-76.0017Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007859Metagenome / Metatranscriptome343Y
F010081Metagenome / Metatranscriptome308Y
F042296Metagenome / Metatranscriptome158Y

Sequences

Protein IDFamilyRBSSequence
Ga0129333_101930452F010081N/AMQDKINIIIKDYTEKMRGIDNTKSIPMIVKELDGIVYSMYRELYGIRDVRHNNYYLNSFTADDKKGHCC*
Ga0129333_101930453F007859N/AMKKLLLITLLLCTGCSGTSMFLRYSYNRALENLPPCSKVHAINNKYITYSMIENTTNNVYFSITNYYKAYYTVDGDVYKTVKTNARQN*
Ga0129333_101930454F042296N/AMNLFKSIIKWCGVIVYAGFLATVAYAATMPEPIKLYVIYTYKFNERVIEKIYIKKENAQKYCDMYKEHHNYTFEELTISE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.