NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0136847_12664377

Scaffold Ga0136847_12664377


Overview

Basic Information
Taxon OID3300010391 Open in IMG/M
Scaffold IDGa0136847_12664377 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Minnesota - Twin Cities
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1736
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → unclassified Deltaproteobacteria → Deltaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment → Lake Superior Sediments

Source Dataset Sampling Location
Location NameLake Superior, USA
CoordinatesLat. (o)47.1675Long. (o)-89.65985Alt. (m)Depth (m)190
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004347Metagenome / Metatranscriptome442Y
F011655Metagenome / Metatranscriptome288Y

Sequences

Protein IDFamilyRBSSequence
Ga0136847_126643772F011655GGAMIYAVECVHCQETLLTTAQVGDAEARIVADHLETRHPAVLDAAVDFDDLGPAEILHHVRVTNR*
Ga0136847_126643773F004347GAGLNESRGSFGAVQSRFNDISSMDVTGAGALFMSAEYAVKAVIVEHYGFLPPSFKTHHRIVNLSHLIGLWWQLPPDLRAYLADIAPLDPNVLYPRETLPPRDPPRTYETLVSSSSNAEWQQRLTTAPRFIQYIERDVIGNPAAFGKLTF*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.