Basic Information | |
---|---|
Taxon OID | 3300010932 Open in IMG/M |
Scaffold ID | Ga0137843_1093186 Open in IMG/M |
Source Dataset Name | Freshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Hellenic Centre for Marine Research (HCMR) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 518 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool → Kallisti Limnes Metagenome Study |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Santorini, Greece | |||||||
Coordinates | Lat. (o) | 36.45421 | Long. (o) | 25.40539 | Alt. (m) | Depth (m) | 229 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F087318 | Metagenome | 110 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137843_10931862 | F087318 | N/A | DEYVKRNGRLVSDKSEINDASISLKDIWVTQDEKLRVVLDCEKFYERPDTSRSISCFQRNNIXKYQTGDEKLVKYDDVSFDPKTENIQFFKKRLRKAPIFFKVGKFCGDMPKKTAKINWEYKFFNLKANRIDFILL* |
⦗Top⦘ |