NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137843_1106977

Scaffold Ga0137843_1106977


Overview

Basic Information
Taxon OID3300010932 Open in IMG/M
Scaffold IDGa0137843_1106977 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV7-P1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHellenic Centre for Marine Research (HCMR)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1408
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (50.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool → Kallisti Limnes Metagenome Study

Source Dataset Sampling Location
Location NameSantorini, Greece
CoordinatesLat. (o)36.45421Long. (o)25.40539Alt. (m)Depth (m)229
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030780Metagenome184Y

Sequences

Protein IDFamilyRBSSequence
Ga0137843_11069771F030780N/AWXYXFXXQAXLHFGQAYQVAQKIERGTMTDKVKQIIWVFDVETNRKKRIQLQTFLDRANHSFRHENIKYFALEKDRDSFAKECRE*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.