NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137844_1205789

Scaffold Ga0137844_1205789


Overview

Basic Information
Taxon OID3300010934 Open in IMG/M
Scaffold IDGa0137844_1205789 Open in IMG/M
Source Dataset NameMicrobial mat microbial communities from the Kallisti Limnes subsea pool, Santorini, Greece - 2-BIOTECH-ROV9-P3
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterHellenic Centre for Marine Research (HCMR)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1003
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Unclassified → Unclassified → Unclassified → Subsea Pool Microbial Mat → Kallisti Limnes Metagenome Study

Source Dataset Sampling Location
Location NameSantorini, Greece
CoordinatesLat. (o)36.4542567Long. (o)25.40523Alt. (m)Depth (m)229
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F050425Metagenome / Metatranscriptome145Y

Sequences

Protein IDFamilyRBSSequence
Ga0137844_12057891F050425N/AMLRSDPEHAQLADRDYQRKLKLLKLDYGTHSADYMRTDVISESI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.