Scaffold Ga0137784_1318190

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137784_1318190

Scaffold Ga0137784_1318190

Overview

Basic Information
Taxon OID	3300010936 Open in IMG/M
Scaffold ID	Ga0137784_1318190 Open in IMG/M
Source Dataset Name	Marine microbial communities from surface seawater of North Pacific Subtropical Gyre ? Stn. ALOHA, 15m
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Hawaii
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1370
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Microbial Communities From Surface Seawater Of North Pacific Subtropical Gyre - Stn. Aloha, 15M

Source Dataset Sampling Location
Location Name	North Pacific Subtropical Gyre
Coordinates	Lat. (^o)	22.75	Long. (^o)	-158.0	Alt. (m)		Depth (m)	15
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007319	Metagenome	353	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137784_13181903	F007319	AGG	MKTYKQFNEGLKDYSNQGKNVRVPGEDTASFGKLFKDDMKQMGKFKNPKTGKLEGNLFPNPKKGYQVRQFATGRGGLTRTLNPFLGKGQGLRSGPTPLARQTPRLLKSGWKGVGKAIMKNPKLALGALAIGAAAKGIQALRNRK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.