Scaffold Ga0137716_10000019

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137716_10000019

Scaffold Ga0137716_10000019

Overview

Basic Information
Taxon OID	3300010938 Open in IMG/M
Scaffold ID	Ga0137716_10000019 Open in IMG/M
Source Dataset Name	Sediment microbial community from Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA. Combined Assembly of Gp0156111, Gp0156114, Gp0156117
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Wisconsin, Madison
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	341632
Total Scaffold Genes	325 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	245 (75.38%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Neutral → Hot Spring Fe-Si Sediment → Sediment Core Sample Microbial Community From Chocolate Pots Hot Springs, Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Chocolate Pots hot springs, Yellowstone National Park, Wyoming, USA
Coordinates	Lat. (^o)	44.7101	Long. (^o)	-110.7413	Alt. (m)		Depth (m)	.01
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F082323	Metagenome / Metatranscriptome	113	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137716_10000019299	F082323	GAG	MGLIVALALVMGAGVGLAHITPPVLLVSERDAVLGMTGGSTRFFVREVRLTSEERDVIERQWGWRPEDEVYRFYLGRDEAGQLVAAVTFLTEYTIHGPVRVAVGIGSGGKIKGAHVVELTEETYPWLKPLLDQAFTQDYIGRDSRASFGLGERVRRANPESMPQFYAQIVASLIQRGAILFDVAILKRGGGKA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.