Scaffold Ga0139246_1068927

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139246_1068927

Scaffold Ga0139246_1068927

Overview

Basic Information
Taxon OID	3300010969 Open in IMG/M
Scaffold ID	Ga0139246_1068927 Open in IMG/M
Source Dataset Name	Microbial communities from the outside layer of the microbial mat covering an inactive hydrothermal chimney from the Kolumbo submarine volcano, Santorini, Greece - V16_c.out
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Hellenic Centre for Marine Research (HCMR)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	930
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Sphingomonadaceae → Sphingobium → Sphingobium fuliginis	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Chimney Microbial Mat → Inactive Hydrothermal Chimney Metagenome Study

Source Dataset Sampling Location
Location Name	Kolumbo submarine Volcano, Hellenic Volcanic Arc, Aegean Sea, Greece
Coordinates	Lat. (^o)	36.52	Long. (^o)	25.48	Alt. (m)		Depth (m)	503
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040633	Metagenome / Metatranscriptome	161	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139246_10689272	F040633	GAG	MSVIGVRRAKAAFPSGCKSHPAILLQPEAIGAVMEVTK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.