NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0137575_10000433

Scaffold Ga0137575_10000433


Overview

Basic Information
Taxon OID3300010970 Open in IMG/M
Scaffold IDGa0137575_10000433 Open in IMG/M
Source Dataset NameFreshwater microbial communities from the surface of the forest pond in Jussy, Geneva, Switzerland - JEBV1, april 2016
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterFASTERIS
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)8804
Total Scaffold Genes20 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)13 (65.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Pond → Unclassified → Pond Fresh Water → Freshwater Microbial Communities From The Surface Of The Forest Pond In Jussy, Geneva, Switzerland

Source Dataset Sampling Location
Location NameJussy, Geneva, SWITZERLAND
CoordinatesLat. (o)46.25Long. (o)6.28Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000473Metagenome / Metatranscriptome1097Y
F012975Metagenome / Metatranscriptome275Y
F037227Metagenome / Metatranscriptome168Y

Sequences

Protein IDFamilyRBSSequence
Ga0137575_1000043312F000473N/AMEEDKKMTFIDKSKDHFKFGVNEWTGEPKKPVFYTDEMRKRVREIPKPTYDLLMDVVMYPDFLAIRLYEDNFLQFDGNKKEMVIEYVSKVKRLIESYGVRCELEGSPSERVL*
Ga0137575_1000043314F012975AGGMLNLTLKGVEVFIDKSKTKNQESFWDNYDLVIWKQDQSGYTSIKGMFRKNSWGLAEKISVDSHGIWKLPTKYVKHFR*
Ga0137575_100004334F037227GGAGGMANMTVLEGIIEDVSVELYQKLWNAIPVEEQTEDSSKAIGLNSRETTLFVIQSFMNKFNAAAEELKDK*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.