Scaffold Ga0139311_1005631

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0139311_1005631

Scaffold Ga0139311_1005631

Overview

Basic Information
Taxon OID	3300010998 Open in IMG/M
Scaffold ID	Ga0139311_1005631 Open in IMG/M
Source Dataset Name	Rumen fluid microbial communities from healthy moose, Palmer, Alaska - F02
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Ohio State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	18046
Total Scaffold Genes	26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	20 (76.92%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location
Location Name	Palmer, Alaska
Coordinates	Lat. (^o)	61.5997	Long. (^o)	-148.112	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102241	Metagenome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0139311_10056312	F102241	AGG	MKTFFYTTIENQLRDDGSYGLLYDHFTDENQAYAKFYTICAAAAVSSIPYHAAHLVRSDGIMIEGKVFDRRSTEEPDEDIPDGGEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.