NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139362_1285234

Scaffold Ga0139362_1285234


Overview

Basic Information
Taxon OID3300011008 Open in IMG/M
Scaffold IDGa0139362_1285234 Open in IMG/M
Source Dataset NameRumen microbial communities from healthy moose, Palmer, Alaska. Combined Assembly of Gp0161001, Gp0160600, Gp0160599, Gp0160598
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterOhio State University
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1031
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Mammals → Digestive System → Foregut → Rumen → Moose Rumen → Rumen Microbial Communities From Healthy Moose, Palmer, Alaska

Source Dataset Sampling Location
Location NamePalmer, Alaska
CoordinatesLat. (o)61.5997Long. (o)-148.1128Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F089667Metagenome / Metatranscriptome108N

Sequences

Protein IDFamilyRBSSequence
Ga0139362_12852341F089667N/ADGIENHKQSSAVMDQTAKNELRKSHFIFGNFEPNYNTTFRREYYNKFNSLPKDKIDFSNIERKLRTQNFQFGTDKPDYLSETAAKYIIPQRNKEEDKQNKVSTAMLQQSHYVFGNHQVPWNTTNRREFTPKKADLIKGTKDLTRTNFILGNDKPTIKSVNEETFVKHPLQKSQIDRNLLNDLRSHHFEFGRDEVPNQHITQNQLTYKNPNIYGNQGQFKPLLDNQLLRQTHWSMGDKTQELPNMYDSTYTRAHTPKKIEKKLIKNVNTFKSSFNINGNGPMIYQTDYRANYIPLSNKINPKEKKIIDDVIKTIKNSHFNLGNMKNDYNTVMNNSYQFNPDEAQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.