NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139557_1000388

Scaffold Ga0139557_1000388


Overview

Basic Information
Taxon OID3300011010 Open in IMG/M
Scaffold IDGa0139557_1000388 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10640
Total Scaffold Genes27 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (14.81%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)41.825Long. (o)-82.975Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007169Metagenome / Metatranscriptome356N
F059659Metagenome / Metatranscriptome133N

Sequences

Protein IDFamilyRBSSequence
Ga0139557_100038813F059659AGGAGGMGMYNSVDCHCPLPMPEDPKGYTGSHSFQTKDFECALDVYIIDKDGQLLIERRDSEWIEGDPNGKSFLDKMGHVKTIKTWLEPLTNTCTIQFYDFIDSNKTDYDYFITYEAVFINGKISSVKIINFEANDNAKRKIRDIEFAEKNKEFYKFRQTWKYKYFIKPYNRSVSFIFFKTIKVLSFLSTTLYKIERNIRI*
Ga0139557_10003885F007169N/AMSYQLQFDFETLEQKEKRLKDWHDQQVKLNKMFEGKANDYYIYNKYVDQFIDFLPYRLGWGLRGNYNELRWWIKCQYQKFRYGVCDDEIYSLETNIAKYMVPRLQYFKKKGKMGIPMKFLPSNYDNLQDEDREKAEKIGEKEINRILDEMIFAFDYIIDPDKYAPFPKSCSWDIKDKNYFNRERTLEAKQCWDEYIETCEQLDARKKQGLQFFVDHMDMLWI*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.