NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0139557_1008276

Scaffold Ga0139557_1008276


Overview

Basic Information
Taxon OID3300011010 Open in IMG/M
Scaffold IDGa0139557_1008276 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Western Basin Lake Erie, Ontario, Canada - Station 970 - Surface Ice
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterMolecular Research LP (MR DNA)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2100
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Freshwater → Freshwater Microbial Communities From Central Basin Lake Erie, Ontario, Canada

Source Dataset Sampling Location
Location NameOntario, Canada
CoordinatesLat. (o)41.825Long. (o)-82.975Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039142Metagenome / Metatranscriptome164Y
F092056Metagenome / Metatranscriptome107Y
F093292Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0139557_10082761F093292AGGAMPRKKIGAGKIKSPGVAQDLEVLNTYYEYTAPDATVVLLNRYEWTRGLGITDKNVKKAQAARHREVAKGFARTEEA*
Ga0139557_10082763F039142GGAGMMRKGNIMKTFTTPQLVDQLMSNLRILAGSADKNSYITGYISACLADIAEKGVDELVAIVDYTNQRIECDEYNKRADARRQEWVDKEFA*
Ga0139557_10082764F092056GGAGMNEQRILASGLANAPDAFDYIYECISGNHGKELFEYVNDLYQSVSIDYRLHPDDDFEDIINRVLDDLGA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.