Scaffold Ga0150979_1139427

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0150979_1139427

Scaffold Ga0150979_1139427

Overview

Basic Information
Taxon OID	3300011012 Open in IMG/M
Scaffold ID	Ga0150979_1139427 Open in IMG/M
Source Dataset Name	Marine surface microbial communities from Baltic Sea. Combined Assembly of 24 SPs
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Berlin Center for Genomics in Biodiversity Research (BeGenDiv)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	522
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Pelagic → Unclassified → Marine → Marine Surface Microbial Communities From Baltic Sea - Bioacid_Cyano

Source Dataset Sampling Location
Location Name	Baltic Sea
Coordinates	Lat. (^o)	57.32	Long. (^o)	20.05	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035784	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0150979_11394271	F035784	N/A	NAEAGDCTPDNYGPTEAADGNIFSWAPTSGRYLRHWSGRGQNVGIHFLEIDVYGCAGESCAYDICESTCDTPINLDQLDGVMAIGGPGVDTRGNPNAVIDMDHTPGLWTVSPTGGFETCADQLYMTIDLGRPHTTTGATIWHYYGNGRAYCSQKLAMSVAGLFVGEETVVYDT

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.