NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151515_10070

Scaffold Ga0151515_10070


Overview

Basic Information
Taxon OID3300011114 Open in IMG/M
Scaffold IDGa0151515_10070 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)39824
Total Scaffold Genes65 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)55 (84.62%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.947421Long. (o)127.818872Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066596Metagenome126Y
F094997Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0151515_1007020F094997AGGVITSNLRLVRNALEKAGKSLDDGARNARDEMMVTLIQLSKEEIQGRRPDGQKAQSGQPPMNRTGNLRRSIRGEKFRTGFGKYEAIVGPTIIYGRAVELGGNWSPPSWRGTSATKGFPYMAPAFKKFMVIAPRIVAKHLSVGGR*
Ga0151515_1007053F066596N/AMRERKGLMVTPQGIENRLVALSKEVDESHQFLESAEYKYHTAKASYEIAIAQARLSFAGEKFRVQDVQDQALLICKDKYEALNVAEATVKAARANATRIRTQVDIARSIGTSVRASLEM*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.