NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0151515_10138

Scaffold Ga0151515_10138


Overview

Basic Information
Taxon OID3300011114 Open in IMG/M
Scaffold IDGa0151515_10138 Open in IMG/M
Source Dataset NameFreshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterChunlab, Inc
Sequencing StatusFinished

Scaffold Components
Scaffold Length (bps)33258
Total Scaffold Genes39 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)30 (76.92%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location NameGangwon-do, South Korea
CoordinatesLat. (o)37.947421Long. (o)127.818872Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F011374Metagenome / Metatranscriptome291Y
F036230Metagenome / Metatranscriptome170Y
F037636Metagenome / Metatranscriptome167Y
F091909Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
Ga0151515_1013815F091909GGAGGVTENNLIPYSVYLPPKYHKKIKELAKERKASSTVRDALCMILDGDDSYQAGYSKGIKDAVKTIKACKEIQVIAISGKYLDNLLCEQIEQLKP*
Ga0151515_101382F037636GGAMIKLELPIDAVNMILGALGELPAKTNAMALMLLIKEQADPQVPPETVTEQPLTQ*
Ga0151515_101383F011374GGCGGLSSFFKGQAELESSHEKAEVQREENKRKGIKDDLATQAIDNVMYLRQTKQFYADLEKMVRWEMGQPDLWREIVEEYQRLLDQKAEDNARELHKKRVSEWRRQRLKNKILDRALETVGVVFVVVYLIILMWMISLHKRGRLDTYLS*
Ga0151515_1013834F036230GGAMTQDLKIGDIVQVHPDKEMFGACMVVVTELKSWGIQGYVQSAGVPGQQYIRLKFDEFEPTGGKAVWVVGEQA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.