Scaffold Ga0151515_10995

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0151515_10995

Scaffold Ga0151515_10995

Overview

Basic Information
Taxon OID	3300011114 Open in IMG/M
Scaffold ID	Ga0151515_10995 Open in IMG/M
Source Dataset Name	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016Feb
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Chunlab, Inc
Sequencing Status	Finished

Scaffold Components
Scaffold Length (bps)	10880
Total Scaffold Genes	13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (61.54%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater → Freshwater Viral Communities From Lake Soyang, Gangwon-Do, South Korea

Source Dataset Sampling Location
Location Name	Gangwon-do, South Korea
Coordinates	Lat. (^o)	37.947421	Long. (^o)	127.818872	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F103122	Metagenome / Metatranscriptome	101	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0151515_109955	F103122	AGG	MMTLEEIRQALSDRMPTKVAEATGVHYNTIRALRDNPDANPTHKVLVALSTYFESRKVTHG*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.