Basic Information | |
---|---|
Taxon OID | 3300011194 Open in IMG/M |
Scaffold ID | Ga0137479_100205 Open in IMG/M |
Source Dataset Name | Arctic soil microbial communities form glacier forefield, Midre Lovenbreen, Svalbard, Norway (Sample 14 - S13.2.55.2.a - transect 2, repeat 2, age 50-113 years, surface depth). |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 9005 |
Total Scaffold Genes | 10 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 7 (70.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Midre Lovenbreen Svalbard, Norway | |||||||
Coordinates | Lat. (o) | 78.90055556 | Long. (o) | 12.07611111 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000265 | Metagenome / Metatranscriptome | 1420 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137479_1002054 | F000265 | AGGA | MPELRGIQATDDVKAEWTRAYDIYLSAPGDRYDKKNDRTARIDSVAKELRLTRKQAKRRVRNYEAWQRNISKKLVSP* |
⦗Top⦘ |