Basic Information | |
---|---|
Taxon OID | 3300011249 Open in IMG/M |
Scaffold ID | Ga0137489_1031447 Open in IMG/M |
Source Dataset Name | Basal ice microbial communities from dark ice on Arctic glacier surface, Midre Lovenbreen, Svalbard, Norway (sample 23) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Bristol |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 524 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Basal Ice → Metagenomes Of Arctic Soils |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Midre Lovenbreen Svalbard, Norway | |||||||
Coordinates | Lat. (o) | 79.48416667 | Long. (o) | 12.09222222 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035895 | Metagenome / Metatranscriptome | 171 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0137489_10314471 | F035895 | N/A | FPGMDTDNQGNRIAFGSPTTDYGFTQDEYFAGRSPQADTFSPI* |
⦗Top⦘ |