Scaffold Ga0137489_1031447

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0137489_1031447

Scaffold Ga0137489_1031447

Overview

Basic Information
Taxon OID	3300011249 Open in IMG/M
Scaffold ID	Ga0137489_1031447 Open in IMG/M
Source Dataset Name	Basal ice microbial communities from dark ice on Arctic glacier surface, Midre Lovenbreen, Svalbard, Norway (sample 23)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Bristol
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	524
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Unclassified → Unclassified → Unclassified → Basal Ice → Metagenomes Of Arctic Soils

Source Dataset Sampling Location
Location Name	Midre Lovenbreen Svalbard, Norway
Coordinates	Lat. (^o)	79.48416667	Long. (^o)	12.09222222	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035895	Metagenome / Metatranscriptome	171	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0137489_10314471	F035895	N/A	FPGMDTDNQGNRIAFGSPTTDYGFTQDEYFAGRSPQADTFSPI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.